Research use only
Tesamorelin Peptide
Tesamorelin Peptide (Tesa) cost and available sizes below.
Third-party COA published · Ships same day
Ships every month · Cancel anytime · Subscription terms
Secure Checkout With
Tesamorelin in a Research Panel: $86.25/vial (reg $115.00)
Pick any 4 · 25% off · one-time
Orders ship via FedEx 2Day or FedEx Overnight. Orders placed before 12 PM (noon) ET, Monday–Friday, go out the same day; nothing ships on weekends.
- Preparation form
- Lyophilized powder
- Storage
- Sealed vial, protected from light
- Analytical purity
- >99%
- Intended use
- In vitro research only
Over 99% pure peptides
Every peptide is analysed by an independent laboratory and documented on a certificate of analysis for that batch.
Shipped from the USA
Stocked, handled and fulfilled domestically. Orders placed before 12 PM (noon) ET, Monday–Friday, go out the same day.
Qualified buyers can buy tesamorelin peptide online from HEEZ Research, which stocks it in 10 mg lyophilized vials and ships from the USA, usually the same day for orders placed before 12 PM ET, Monday–Friday. Everything HEEZ supplies is for in vitro laboratory research — not for human or veterinary use.
Yes — tesamorelin peptide is for sale online at HEEZ Research. Every lot is independently tested by an accredited third-party laboratory using HPLC for purity and identity, and every peptide we sell is over 99% pure. The certificate of analysis for the current lot is published on this page — review it before you order. A certificate records the identity, purity and quantity measured for the material supplied, so you can confirm what you received matches what was ordered.
Tesamorelin peptide, also called Tesa, is a synthetic 44-amino-acid GHRH analogue, CAS 218949-48-5, molecular formula C221H366N72O67S. A trans-3-hexenoyl group on the N-terminal tyrosine distinguishes it from the native GHRH(1-44) sequence. HEEZ Research supplies it as a lyophilized powder with a per-batch COA published online.
Tesamorelin peptide from HEEZ Research is sold in 10 mg vials, and the cost per vial drops on 3- and 5-vial orders from the same lot. Current tesamorelin prices for each quantity are shown in the selector above.
HEEZ Research sells tesamorelin peptide (Tesa 10 mg) in 10 mg sealed glass vials of lyophilized powder. Multi-vial orders ship from a single lot.
Look for a supplier that publishes a third-party certificate of analysis for the exact lot you receive, ships domestically, and sells strictly for research. HEEZ Research publishes the lot-specific COA on this page, ships tesamorelin peptide from the USA, and supplies it for in vitro research only.
Please refer to your facility’s standard operating procedures.
Tesamorelin is available to buy for research from HEEZ Research as a research-use-only compound supplied to qualified laboratories. Checkout requires an institutional email matching your stated organization, and everything we sell is for in vitro laboratory research — not for human or veterinary use.
Common
questions
Purity verification, documentation, and how orders reach your laboratory.
Technical data
- CAS
- 218949-48-5
- Molecular formula
- C221H366N72O67S
- Molecular mass
- 5135.76 g/mol
- Length
- 44 residues
- Sequence
- (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
- Modifications
- N-terminal trans-3-hexenoyl on Tyr1
- C-terminal amide
- Form
- Lyophilized powder, sealed glass vial
- Purity
- ≥99% (HPLC) · batch COA
Identifiers
QBEPNUQJQWDYKU-BMGKTWPMSA-NAbout Tesamorelin
What is tesamorelin peptide?
Tesamorelin peptide is a synthetic 44-amino-acid GHRH analogue, supplied by HEEZ Research as a lyophilized powder for in vitro laboratory use. Its sequence is the full-length GHRH(1-44) amide with a trans-3-hexenoyl group on the N-terminal tyrosine — that single acylation distinguishes it from native GHRH(1-44) and from the truncated GHRH(1-29) fragments. Because the whole 44-residue sequence is retained, tesamorelin is the closest full-length reference standard in the GHRH-analogue group.
How does tesamorelin work?
In vitro, tesamorelin is characterized as an agonist at the GHRH receptor family, with the N-terminal acyl group conferring resistance to DPP-4 cleavage in assay media. Receptor activity is measured in GHRH-receptor-expressing cell lines.
How HEEZ tests tesamorelin
Tesamorelin is produced by solid-phase peptide synthesis, purified by reversed-phase chromatography and lyophilized. Every lot is sent to an independent third-party laboratory and analysed by HPLC for purity and identity (retention time against a reference standard). The certificate for the current lot is shown at the top of this page.
Tesamorelin for sale: sizes and format
Tesamorelin peptide is for sale online from HEEZ Research in 10 mg sealed glass vials of lyophilized powder. Ordering 3 or 5 vials lowers the cost per vial, allowing your institution to run additional studies on the same budget. Vials ship at ambient temperature from the USA via FedEx — same day for orders placed before 12 PM (noon) ET, Monday–Friday. The price for each quantity is shown in the selector above.
Research use only
Tesamorelin from HEEZ Research is supplied strictly for in vitro laboratory research by qualified researchers and organizations. It is not for human or veterinary use and is not a drug, food, supplement or cosmetic. Checkout requires an institutional email matching the stated organization, and purchasers must be 21 or older. All sales are final.
Tesamorelin specifications
- Purity
- >99% by HPLC; identity by HPLC retention time against a reference standard
- CAS number
- 218949-48-5
- Molecular formula
- C221H366N72O67S
- Molecular mass
- 5135.76 Da
- Amino acid count
- 44
- Structure
- C-terminal amide
- Synonyms
- TH9507
- Physical form
- White lyophilized powder
Identity confirmed by HPLC retention time on the current lot.
You may also need
View entire catalogTerms of sale
Note: our products are not intended to treat, prevent, mitigate or cure any disease or medical condition, and are supplied for laboratory research purposes only. Purchasers must be at least 21 years of age and qualified to handle research materials.